Glyma10g34290 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma10g34290

Feature Type:	gene_model
Chromosome:	Gm10
Start:	42443360
stop:	42445233
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma10g34290

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G10520	AT	Annotation by Michelle Graham. TAIR10: haemoglobin 2 \| chr3:3276516-3277765 REVERSE LENGTH=158	SoyBase	E_val: 3.00E-43	ISS
GO:0006631	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid metabolic process	SoyBase	N/A	ISS
GO:0009735	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus	SoyBase	N/A	ISS
GO:0015671	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxygen transport	SoyBase	N/A	ISS
GO:0019432	GO-bp	Annotation by Michelle Graham. GO Biological Process: triglyceride biosynthetic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005344	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxygen transporter activity	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0019825	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxygen binding	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
PTHR22924	Panther	LEGHEMOGLOBIN	JGI		ISS
PTHR22924:SF4	Panther	NON-SYMBIOTIC HEMOGLOBIN (RHB)	JGI		ISS
PF00042	PFAM	Globin	JGI		ISS
UniRef100_P02238	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Leghemoglobin A n=3 Tax=Glycine max RepID=LGBA_SOYBN	SoyBase	E_val: 7.00E-97	ISS
UniRef100_P02238	UniRef	Annotation by Michelle Graham. Best UniRef hit: Leghemoglobin A n=3 Tax=Glycine max RepID=LGBA_SOYBN	SoyBase	E_val: 7.00E-97	ISS

Proteins Associated with Glyma10g34290

Locus	Gene Symbol	Protein Name
	Lbc2D	Leghemoglobin C2 gene D

Expression Patterns of Glyma10g34290

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma10g34290 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.10g199100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma10g34290

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma10g34290

Limit To All Plant Sequences

>Glyma10g34290.1   sequence type=CDS   gene model=Glyma10g34290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGCTTTCACTGAGAAGCAAGATGCTTTGGTGAGTAGCTCATTCGAAGCATTCAAGGCAAACATTCCTCAATACAGCGTTGTGTTCTACACTTCGATACTGGAGAAAGCACCTGCAGCAAAGGACTTGTTCTCATTTCTAGCAAATGGAGTAGACCCCACTAATCCTAAGCTCACGGGCCATGCTGAAAAGCTTTTTGCATTGGTGCGTGACTCAGCTGGTCAACTTAAAGCAAGTGGAACAGTGGTGGCTGATGCCGCACTTGGTTCTGTTCATGCCCAAAAAGCAGTCACTGATCCTCAGTTCGTGGTGGTTAAAGAAGCACTGCTGAAAACAATAAAGGCAGCAGTTGGGGACAAATGGAGTGACGAGTTGAGCCGTGCTTGGGAAGTAGCCTACGATGAATTGGCAGCAGCTATTAAGAAGGCATAA

Predicted protein sequences of Glyma10g34290

Limit To All Plant Sequences

>Glyma10g34290.1   sequence type=predicted peptide   gene model=Glyma10g34290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLANGVDPTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDELSRAWEVAYDELAAAIKKA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain